DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG8172

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:259 Identity:76/259 - (29%)
Similarity:118/259 - (45%) Gaps:53/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NGRVVGGEDAVKNQFPHQVSLRNAG----SHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAE 89
            :.|:|||........|.||:|..:|    ..||||:::|..:|:||||||.:  :..:::.|...
  Fly   313 SNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVAS--TPNSNMKIRLG 375

  Fly    90 RFTIRAGSNDRFSGGVLVQVAEVIVHEEYG-------------NFLNDVALLRLESPLILSASIQ 141
            .:.:| |..:|.:            |||||             :|:|||||:||:..::....|.
  Fly   376 EWDVR-GQEERLN------------HEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHII 427

  Fly   142 PIDLPTADTPADVDV-IISGWGRIKH-QGDLPRYLQYNTLKSISLERCDELIGWGVQSELCLIHE 204
            |:.||.:.|.....: .::||||.:| |..:|..||...::.||.:||........:.|  .||:
  Fly   428 PVCLPPSTTKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRRE--AIHD 490

  Fly   205 A-------DNG--ACNGDSGGPAVY----NNQVVGVAGFVWS-ACGTSY-PDGYARVYYHNEWI 253
            .       |.|  :|.||||||...    ...::|:..  |. .||..: |..|..:.....||
  Fly   491 VFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVS--WGIGCGREHLPGVYTNIQRFVPWI 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 74/255 (29%)
Tryp_SPc 32..256 CDD:238113 75/256 (29%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 74/255 (29%)
Tryp_SPc 316..555 CDD:238113 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457736
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.