DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG8586

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:269 Identity:66/269 - (24%)
Similarity:109/269 - (40%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HSAPGSL---NGRVVGGED-AVKNQFPHQVSL-RNAGSHSCGGSILSRNYVLTAAHCVTNQDSNG 81
            :|.|..|   |.:....|| ::..:||..|.: .......|||:::....|:|.:|.:.|:    
  Fly   174 YSNPKGLIPDNDKFPYSEDVSIFGEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLVNE---- 234

  Fly    82 NSVPIAAERFTIRAGSNDRFS--------GGVLVQVAEVIVHEEY--GNFLNDVALLRLESPLIL 136
                 ..:....|||..|..|        |.   ::.|:|:|.|:  .:..||:|||.|:.|:.|
  Fly   235 -----TVDTLVARAGDWDLNSLNEPYPHQGS---RIKEIIMHSEFDPNSLYNDIALLLLDEPIRL 291

  Fly   137 SASIQPIDLPTADTPADVDVIIS------GWGRIKHQGD-LPRYLQYNTLKSISLERCD-ELIGW 193
            :..|||:.||..::|...:.::|      |||..:...| |...|:...|..:..|.|. :|...
  Fly   292 APHIQPLCLPPPESPELTNQLLSVTCYATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNT 356

  Fly   194 GVQ-------SELCLIHEADNGACNGDSGGP-------AVYNNQVVGVAGFVWSACGTSYPDGYA 244
            .::       |.:|...:.....|.||.|.|       .:...|:||:..:.........|..|.
  Fly   357 RLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYV 421

  Fly   245 RVYYHNEWI 253
            .|.:...||
  Fly   422 NVPHLRGWI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 60/255 (24%)
Tryp_SPc 32..256 CDD:238113 62/256 (24%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 60/246 (24%)
Tryp_SPc 197..430 CDD:214473 58/244 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457446
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.