DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG18563

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster


Alignment Length:223 Identity:58/223 - (26%)
Similarity:92/223 - (41%) Gaps:34/223 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQ----VAEVIVHEE- 117
            |||::|...:|||||...|:        :..:|..:|||.....:....:|    |.|.||..| 
  Fly   160 GGSLISPKVILTAAHNTMNK--------MNEDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHEG 216

  Fly   118 --YGNFLNDVALLRLESPLILSASIQPIDLPTADTPAD-VDVIISGWGRI-KHQGDLPRYLQYNT 178
              :.:.:|:|||:.:::|.:|:..|..:.||:.....: ....::||..: .|.....|.::...
  Fly   217 FIFQSGINNVALIFVKTPFVLNDRIGVLTLPSRQASFEGRRCTVAGWDLVSSHDQSRMRIIKKLE 281

  Fly   179 LKSISLERC-----DELIGWGVQ---SELCLIHEADNGACNGDSGGPAVY------NNQVVGVAG 229
            |..:....|     :..:|....   |.:|...|.:...|.| .||.|::      |..|...||
  Fly   282 LTVLDRTTCVAQFRNTTLGRNFDLHPSLICARSEINRDFCFG-GGGYALFCSLGDENPHVFEQAG 345

  Fly   230 FV-WS-ACGTSYPDGYARVYYHNEWIKN 255
            .| |. .||...|..|..|.....||.|
  Fly   346 IVAWGMGCGLDLPGIYTNVAMFRSWIYN 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 55/219 (25%)
Tryp_SPc 32..256 CDD:238113 58/223 (26%)
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 57/221 (26%)
Tryp_SPc 147..371 CDD:214473 55/219 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457574
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.