DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG4793

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:281 Identity:73/281 - (25%)
Similarity:107/281 - (38%) Gaps:69/281 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PVHSAPGSLNGRVVG------GEDAVKNQFPHQVSLRNAGSH--SCGGSILSRNYVLTAAHCVTN 76
            |:.:..|.:|...||      .:.|.|.:.|..|:|.::.|.  ..|||:::|:.|||       
  Fly    81 PLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLT------- 138

  Fly    77 QDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG-------------NFLNDVALL 128
              |:..::.:..:...:|||..|      ...:.|...||:..             |..|:.|||
  Fly   139 --SSTKTLEVPEKYLIVRAGEWD------FESITEERAHEDVAIRKIVRHTNLSVENGANNAALL 195

  Fly   129 RLESPLILSASIQPIDLPTADTPADVD-----VIISGWGRIKHQGDLPRYLQYNTLKSISLERCD 188
            .|..||.|...|..|.||    |.:.:     .|:||||: |...| ..|:  |.||.|.|...|
  Fly   196 FLARPLKLDHHIGLICLP----PPNRNFIHNRCIVSGWGK-KTALD-NSYM--NILKKIELPLVD 252

  Fly   189 ELI-------GWGV-----QSELCLIHEADNGACNGDSGGPAV-------YNNQVVGVAGFVWSA 234
            ..:       .:|.     .|.:|...|.....|.||.|.|..       ...:::|:..|.: .
  Fly   253 RSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGF-G 316

  Fly   235 CGTSYPDGYARVYYHNEWIKN 255
            ||...|..|..|.....||.|
  Fly   317 CGGPLPAAYTDVSQIRSWIDN 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 67/266 (25%)
Tryp_SPc 32..256 CDD:238113 70/269 (26%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 67/255 (26%)
Tryp_SPc 105..335 CDD:214473 65/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457610
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.