DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG18478

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:264 Identity:69/264 - (26%)
Similarity:111/264 - (42%) Gaps:61/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GGEDAVKNQ------------FPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPI 86
            |..||||.|            ||..:::.:..|...|||:::.:.||||||.:.|:|        
  Fly    34 GNPDAVKVQFNVTEGQAKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKD-------- 90

  Fly    87 AAERFTIRAGSNDRFSGGVLVQ-------VAEVIVHE--EYGNFLNDVALLRLESPLILSASIQP 142
             .|...:.||..:  .|..|.:       |.::::|:  .|....|::|||.|:....|:..|..
  Fly    91 -VEDIVVSAGEWE--YGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINT 152

  Fly   143 IDLPTAD-TPADVDVIISGWGRIK----HQG------DL---PRYLQYNTLKSISLERCDELIGW 193
            |.|||.. :.:....|::|||:.:    |.|      ||   ||::..:.|:...|.:...|   
  Fly   153 ICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTL--- 214

  Fly   194 GVQSELCLIHEADNGACNGDSGG---------PAVYNNQVVGVAGFVWSACGTSYPDGYARVYYH 249
             .:..:|...|.||.||.||.||         |..:  :.:|:..:.......:.|..|..|:..
  Fly   215 -PRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQF--EQIGIVNWGVGCKEKNVPATYTDVFEF 276

  Fly   250 NEWI 253
            ..||
  Fly   277 KPWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 67/262 (26%)
Tryp_SPc 32..256 CDD:238113 69/264 (26%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 63/248 (25%)
Tryp_SPc 50..280 CDD:214473 61/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.