DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Send2

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:259 Identity:89/259 - (34%)
Similarity:123/259 - (47%) Gaps:37/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILLGSFLLLLAVPVHSAPGSL--NGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTA 70
            :.:.|||||||:...||...:  ..|::||:.....:.|.|||::..|.|.|||||.|.:.::||
  Fly     1 MFIQSFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITA 65

  Fly    71 AHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPLI 135
            ||||..|.            :.:||||..:.|.|.:|.||.:..||..|   ||:|::||..||.
  Fly    66 AHCVQGQG------------YQVRAGSALKNSNGSVVDVAAIRTHEGLG---NDIAIVRLSKPLE 115

  Fly   136 LSASIQPIDLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIGW----GV- 195
            .:..:|||.|...:.|......:||||...:..           ..|.|:..:..|.|    |: 
  Fly   116 FTNQVQPIPLAKTNPPPGSIAFVSGWGSSSYYS-----------HPIDLQGVNLYIQWPYYCGLT 169

  Fly   196 -QSELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIKNNSD 258
             .|.:| .......||.||||||.|::.|:|||.......|  :|...|..|.|..|||.|..|
  Fly   170 EPSRIC-AGSFGRAACKGDSGGPLVFDQQLVGVVSGGTKDC--TYSSIYTSVPYFREWILNAID 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 76/227 (33%)
Tryp_SPc 32..256 CDD:238113 77/229 (34%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 76/227 (33%)
Tryp_SPc 27..225 CDD:238113 75/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.