DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG31954

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:291 Identity:88/291 - (30%)
Similarity:142/291 - (48%) Gaps:46/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSVKAAILLGSFLLLLA----VP-----------VHSAPGS----LNGRVVGGEDAVKNQFPHQ 46
            |.:::..:||...||:||    :|           |...|..    |:||:|||........|||
  Fly     1 MLALRLFVLLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQ 65

  Fly    47 VSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAE 111
            |||:.: ||.|||||:|..::||||||...:         .|:|..:|.|:::....|.|::|.:
  Fly    66 VSLQTS-SHICGGSIISEEWILTAAHCTYGK---------TADRLKVRLGTSEFARSGQLLRVQK 120

  Fly   112 VIVHEEYGNFLN---DVALLRLESPLILSASIQPIDLPTA-----DTPADVDVIISGWGRIKHQG 168
            ::.|.:: |:.|   |.:||:|..|:....:.:.:.||.:     |..|   ..:||||..::..
  Fly   121 IVQHAQF-NYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEA---CFVSGWGNTQNLL 181

  Fly   169 DLPRYLQYNTLKSISLERCDE---LIGWGVQSELCL-IHEADNGACNGDSGGPAV-YNNQVVGVA 228
            :...:|:...:..::.|.|.|   ..|...:..:|. ..|....||.||||||.| .:.::|||.
  Fly   182 ESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVV 246

  Fly   229 GFVWSACGTSYPDGYARVYYHNEWIKNNSDV 259
            .:.:......||..|:||.:..:|||.:|.|
  Fly   247 SWGYGCAKPDYPGVYSRVSFARDWIKEHSGV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 71/234 (30%)
Tryp_SPc 32..256 CDD:238113 73/236 (31%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 71/234 (30%)
Tryp_SPc 51..274 CDD:238113 73/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.