DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG40160

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:288 Identity:75/288 - (26%)
Similarity:108/288 - (37%) Gaps:76/288 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PVHSAPGSLNG---RVVGGED----------AVKNQFPHQVSLRNAG--SHSCGGSILSRNYVLT 69
            |:...|....|   |..||.|          |...:||..|:|.::|  |:.|.||::.:..|||
  Fly   140 PLDQRPNQPRGCGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLT 204

  Fly    70 AAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLV-----QVAEVIVHEEYG--NFLNDVAL 127
            |||||.:         :....||:|||..|..:....:     .|..||:|.:|.  :...|.||
  Fly   205 AAHCVES---------LRTGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFAL 260

  Fly   128 LRLESPLILSASIQPIDLPTA-DTPADVDVIIS-GWGRIKHQGDLPRY-----------LQYNTL 179
            :.|..|:.|...|..|.||.. |.|...:...| |||:... |.|.:|           :::|:.
  Fly   261 VILSQPVTLDDHINVICLPQQDDIPQPGNTCFSTGWGKDAF-GSLGKYSSLMKRVPLPIVEFNSC 324

  Fly   180 KS----------ISLERCDELIGWGVQSELCLIHEADNGACNGDSGGPAV--------YNNQVVG 226
            ::          .:|:|          |.:|...:.....|.||.|.|..        ...|..|
  Fly   325 QTRLRGTRLGPKFALDR----------SFICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTG 379

  Fly   227 VAGFVWS-ACGTSYPDGYARVYYHNEWI 253
            :.  .|. .|....|..||.|.....||
  Fly   380 IV--AWGIGCNDEVPAAYANVALVRGWI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 70/272 (26%)
Tryp_SPc 32..256 CDD:238113 71/273 (26%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 68/262 (26%)
Tryp_SPc 169..405 CDD:214473 66/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.