DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and prss60.3

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:252 Identity:79/252 - (31%)
Similarity:121/252 - (48%) Gaps:33/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 APGSLNGRVVGGEDAVKNQFPHQVSLRNA--GSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPI 86
            ||  ||.|:|||.:|....:|.||||.:.  |.|.||||::|..:|||||||::.         :
Zfish    30 AP--LNTRIVGGVNASPGSWPWQVSLHSPKYGGHFCGGSLISSEWVLTAAHCLSG---------V 83

  Fly    87 AAERFTIRAGSNDRFSGGVLV-----QVAEVIVHEEYGNFL--NDVALLRLESPLILSASIQPID 144
            :.....:..|.  |...|:.:     .||:..||..|.:..  ||:|||||.|.:..:..|:|:.
Zfish    84 SETTLVVYLGR--RTQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVC 146

  Fly   145 LPTADT--PADVDVIISGWGRIKHQGDLPR--YLQYNTLKSISLERCDELIGWG--VQSELCL-I 202
            |...::  .|.....|:|||.|:...:||.  .||...:..::.:||:.|:|.|  ..:.:|. :
Zfish   147 LAAQNSVYSAGTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRCNALLGSGTVTNNMICAGL 211

  Fly   203 HEADNGACNGDSGGPAVYNNQVV----GVAGFVWSACGTSYPDGYARVYYHNEWIKN 255
            .:.....|.||||||.|.....|    |:..:.:.....:.|..|.||..:..||.:
Zfish   212 TQGGKDTCQGDSGGPMVTRLCTVWVQAGITSWGYGCADPNSPGVYTRVSQYQSWISS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 73/241 (30%)
Tryp_SPc 32..256 CDD:238113 74/244 (30%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 74/244 (30%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.