DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG3117

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:275 Identity:78/275 - (28%)
Similarity:116/275 - (42%) Gaps:58/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PVHSA--------PGSLNGR-VVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVT 75
            |.||.        |.:|:|. .|.|:....||||...:|...||:..|||:::...||||||.:.
  Fly    71 PQHSVDTLLRTSYPNALDGSPQVFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILA 135

  Fly    76 NQDSNGNSVPIAAERFTIRAG-----SNDRFSGGVLVQVAEVIVHE--EYGNFLNDVALLRLESP 133
            ....|.         ..:|||     |:::.:..:..||.:::.||  .|.:..||:|||.|:||
  Fly   136 GLSPND---------IMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSP 191

  Fly   134 LILSASIQPIDLPTADTPADVDV-IISGWG----------RIKHQGDLPRYLQYNTLKSISLERC 187
            ..|.|:||.|.||..|...|..: .::|||          .|:.:.|||      .::|...:|.
  Fly   192 FELRANIQTIRLPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLP------VVESSKCQRQ 250

  Fly   188 DELIGWGVQSEL-----CLIHEADNGACNGDSGGPAVY--------NNQVVGVAGFVWSACG-TS 238
            ..|...|...:|     |...|.....|: ..||.|::        ..:..|:..| ...|| .:
  Fly   251 LRLTKMGSNYQLPASLMCAGGEEGRDVCS-LFGGFALFCSLDDDPNRYEQAGIVSF-GVGCGQAN 313

  Fly   239 YPDGYARVYYHNEWI 253
            .|..:..|....|||
  Fly   314 VPTTFTHVSKFMEWI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 70/254 (28%)
Tryp_SPc 32..256 CDD:238113 72/254 (28%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 71/251 (28%)
Tryp_SPc 95..328 CDD:214473 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457604
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.