DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG4271

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:258 Identity:87/258 - (33%)
Similarity:130/258 - (50%) Gaps:29/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILLGS--FLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRN---AGSHSCGGSILSRNYV 67
            :|:||  .|:|.|   .|:.|..||        |:.:|.....|.:   :|.|.|||:::....|
  Fly     1 MLIGSCWVLILFA---RSSNGIYNG--------VEAKFDFWTFLASVWVSGYHECGGAVIDSRIV 54

  Fly    68 LTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLES 132
            ||||.||.|:       |:  :|.|:|.|:.|.:.||.:::|..::|||.|.|:.||:|||.||.
  Fly    55 LTAAQCVKNK-------PV--KRITVRVGTPDIYRGGRIIRVTALVVHENYKNWDNDIALLWLEK 110

  Fly   133 PLILSASIQPIDLPTADTPADVDVIISGWG-RIKHQGDLPRYLQYNTLKSISLERCDELIGWGVQ 196
            | :||..:..|.|.|.:...:.....:||| ::.....:.|.||....|......|.|.:...|.
  Fly   111 P-VLSVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEELVEPVG 174

  Fly   197 SELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTS-YPDGYARVYYHNEWIKNNSD 258
            .||......:|..|.||.|||.|..|:|||:| .....||.: .|..|..|:::.|||:.|::
  Fly   175 EELLCAFYTENDICPGDYGGPLVLANKVVGIA-VQGHGCGFAVLPSLYTNVFHYLEWIEENAE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 74/226 (33%)
Tryp_SPc 32..256 CDD:238113 76/228 (33%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 78/233 (33%)
Tryp_SPc 19..231 CDD:214473 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.