DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Prss34

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:280 Identity:84/280 - (30%)
Similarity:132/280 - (47%) Gaps:46/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLLLLAVPV--HSAP-----GSLNGRV--VGGEDAVKNQFPHQVSLR------NAGSHSCGGSIL 62
            :||.|::|.  ::.|     ||..|.|  |||.....::||.|||||      :...|.||||::
Mouse     7 WLLFLSLPCLGNTMPLTLDLGSGQGLVGIVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLI 71

  Fly    63 SRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLN---- 123
            ...:||||||||..::.....|.:...:  :|...||:     |::|.::|.|.::...|:    
Mouse    72 HPQWVLTAAHCVRPKEVEAYGVRVQVGQ--LRLYENDQ-----LMKVVKIIRHPKFSEKLSARGG 129

  Fly   124 -DVALLRLESPLILSASIQPIDLPTAD--TPADVDVIISGWGRIKHQGDL--PRYLQYNTLKSIS 183
             |:|||:|::.::||..:.|:.||.|.  ..:.....::|||.|::...|  |.:|:...:..:.
Mouse   130 ADIALLKLDTRVVLSEHVYPVSLPAASLRISSKKTCWVAGWGVIENYMPLPPPYHLREVAVPIVE 194

  Fly   184 LERCDELIGWGVQSE----------LCLIHEADNGACNGDSGGPAV--YNNQVVGVAGFVWS-AC 235
            ...|::.......|:          ||...|. ..:|..|||||.|  :|...|.|....|. .|
Mouse   195 NNDCEQKYQTNSSSDSTTRIIKDDMLCAGKEG-RDSCKADSGGPLVCRWNCSWVQVGVVSWGIGC 258

  Fly   236 G-TSYPDGYARVYYHNEWIK 254
            | ..:|..|.||..:..|||
Mouse   259 GLPDFPGVYTRVMSYVSWIK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 73/252 (29%)
Tryp_SPc 32..256 CDD:238113 76/254 (30%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 73/250 (29%)
Tryp_SPc 35..277 CDD:214473 72/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.