DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG9676

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:250 Identity:114/250 - (45%)
Similarity:151/250 - (60%) Gaps:7/250 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SFLLLLAVPVHSAPGS-LNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVT 75
            |.|:|.|..|.:...| :..|:|||..|.:.|||||:|||..|||:|||||:|::||:|||||| 
  Fly     7 SLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCV- 70

  Fly    76 NQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPLILSASI 140
               ..||:|..|.| ..|:|||....||||.|.||.|.||..|.:..:|||:|||.:.|..:::|
  Fly    71 ---KQGNNVAPANE-LEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNI 131

  Fly   141 QPIDLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDE-LIGWGVQSELCLIHE 204
            ..|.|.|.|.|.|..|.|||||.|..:|.:...|.|..:|::|.|.|.: .:....::.:||:|.
  Fly   132 AAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHP 196

  Fly   205 ADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIKNNSDV 259
            .|.|||.|||||||.|..::||:|.||...||.:.||||.||.....||...:.:
  Fly   197 KDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEKASL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 106/222 (48%)
Tryp_SPc 32..256 CDD:238113 107/224 (48%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 106/222 (48%)
Tryp_SPc 28..248 CDD:238113 107/224 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473223
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H114140
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D121264at33392
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 1 1.000 - - otm47449
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.