DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and prss59.1

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:264 Identity:71/264 - (26%)
Similarity:118/264 - (44%) Gaps:30/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSVKAAILLGSFLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRN 65
            |||:...:|||:...|           .:.::|||.:...|..|.|.|| |:|.|.||||::|..
Zfish     1 MRSLVFLVLLGAAFAL-----------DDDKIVGGYECQPNSQPWQASL-NSGYHFCGGSLVSEY 53

  Fly    66 YVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNF--LNDVALL 128
            :|::||||..::    ..|.:......|..|:..      .:...:||.:..|.::  .:|:.|:
Zfish    54 WVVSAAHCYKSR----VEVRLGEHNIVINEGTEQ------FITSEKVIRNPNYDSWDLDSDIMLI 108

  Fly   129 RLESPLILSASIQPIDLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELI-G 192
            :|..|..|:..:||:.||...........:||||...........||...:..:|...|:... |
Zfish   109 KLSKPATLNKYVQPVALPNGCAADGTMCRVSGWGNTMSSTADSNKLQCLEIPILSDRDCNNSYPG 173

  Fly   193 WGVQSELCLIH-EADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWI--- 253
            ....:..|..: |....:|.||||||.|.|.::.|:..:.:.....::|..|.:|...::||   
Zfish   174 MITDTMFCAGYLEGGKDSCQGDSGGPVVCNGELHGIVSWGYGCAEKNHPGVYGKVCMFSQWIADT 238

  Fly   254 -KNN 256
             :||
Zfish   239 MRNN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 60/225 (27%)
Tryp_SPc 32..256 CDD:238113 62/231 (27%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 60/225 (27%)
Tryp_SPc 21..238 CDD:238113 62/227 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.