DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG32834

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:267 Identity:86/267 - (32%)
Similarity:130/267 - (48%) Gaps:36/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLLLLAVPVHSAPGSLN--GRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVT 75
            ||.|||..:....|.|:  .|::||.|......|:|..:...|:..|.|:|::.:.::|||.||.
  Fly     6 FLFLLAALLRPVRGDLDAQSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITAASCVQ 70

  Fly    76 NQDSNGNSVPIAAERFTIRAGSNDR-FSG-GVLVQVAEVIVHEEYG--NFLNDVALLRLESPLIL 136
            :..|           ..:|.|::.| :.| |.|::|.|:|.|.:|.  .|.|::|||:|..||..
  Fly    71 SYGS-----------IEVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKT 124

  Fly   137 SASIQPIDLPTADTPADVD-VIISGWGRI--------KHQGDLPRYLQYNTLKSISLERC--DEL 190
            |.:||||.: ..|.|.|.. ..:||||..        :..|.||.|||...:...:.|:|  |..
  Fly   125 SEAIQPISI-AEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCAADRG 188

  Fly   191 IGWGVQ----SELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNE 251
            :.:|:.    |.|.|......|.|:.|:|.|.|.:.|:||:..  ...| |:.||.||.|.:...
  Fly   189 VWFGLWDNGISYLTLCTHNGAGGCSYDTGAPLVIDGQLVGILS--EGGC-TTKPDVYANVPWFTG 250

  Fly   252 WIKNNSD 258
            ||..|::
  Fly   251 WIAENTE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 76/240 (32%)
Tryp_SPc 32..256 CDD:238113 77/242 (32%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 76/240 (32%)
Tryp_SPc 27..255 CDD:238113 77/242 (32%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.