DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG32523

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:257 Identity:111/257 - (43%)
Similarity:145/257 - (56%) Gaps:28/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLAVPV--------HSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTA 70
            |||..|.|        :.:..::..|:|||..|.:.|||||:|||..|.|.|||.|:|..:|:||
  Fly    11 LLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITA 75

  Fly    71 AHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY---GNFLNDVALLRLES 132
            .|||    .:||.| :.|:.::|:|||....|.||.:.|||||:|..|   |:  ||:|:|||:|
  Fly    76 GHCV----KHGNDV-VPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGH--NDLAVLRLQS 133

  Fly   133 PLILSASIQPIDLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIGWGVQS 197
            ||...|:|..|.|.|.|.|..|.|.|||||.|..:|.|...|.:..:.|||...|    .|...|
  Fly   134 PLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGAC----RWMFYS 194

  Fly   198 EL-----CLIHEADNGACNGDSGGPAVYNNQVVGVAG-FVWSACGTSYPDGYARVYYHNEWI 253
            .|     ||:|..::|||.|||||||.|..:|||:|. .:...||.:.||||.|:.....||
  Fly   195 RLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 104/230 (45%)
Tryp_SPc 32..256 CDD:238113 105/231 (45%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 104/230 (45%)
Tryp_SPc 37..219 CDD:238113 88/192 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473224
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H114140
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7244
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D121264at33392
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.