DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG32376

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:270 Identity:67/270 - (24%)
Similarity:120/270 - (44%) Gaps:36/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GSFLLLLAVPVHSAP----GSLNG---------------RVVGGEDAVKNQFPHQVSLRNAGSHS 56
            |:..||...|...||    |:::.               |:|.|:.....:.|.|.||...|...
  Fly    26 GTHYLLYGKPEDIAPTPNFGNISSNPFINALEAQESFPTRIVNGKRIPCTEAPFQGSLHYEGYFV 90

  Fly    57 CGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNF 121
            ||..|:::.::|||.||...          ..|::|:|.||:.:..||.|..|.:::....|.::
  Fly    91 CGCVIINKIWILTAHHCFFG----------PPEKYTVRVGSDQQRRGGQLRHVKKIVALAAYNDY 145

  Fly   122 L--NDVALLRLESPLILSASIQPIDLP-TADTPADVDVIISGWG-RIKHQGDLPRYLQYNTLKSI 182
            .  :|:|:::|:||:.....::|:.|| |..|......::|||| ...:..::.|||:...:..|
  Fly   146 TMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKFVVSGWGITSANAQNVQRYLRRVQIDYI 210

  Fly   183 SLERCDEL---IGWGVQSELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYA 244
            ...:|.::   .|..:..::......:..:|:||||||......:.|:..:.......:||..|.
  Fly   211 KRSKCQKMYKKAGLKIYKDMICASRTNKDSCSGDSGGPLTSRGVLYGIVSWGIGCANKNYPGVYV 275

  Fly   245 RVYYHNEWIK 254
            ....:..|||
  Fly   276 NCKRYVPWIK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 57/228 (25%)
Tryp_SPc 32..256 CDD:238113 59/230 (26%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 57/228 (25%)
Tryp_SPc 66..287 CDD:238113 59/230 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457795
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.