DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Klk14

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_777355.1 Gene:Klk14 / 317653 MGIID:2447564 Length:250 Species:Mus musculus


Alignment Length:263 Identity:77/263 - (29%)
Similarity:122/263 - (46%) Gaps:41/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLLL-----LAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHS--CGGSILSRNYVLTA 70
            ||||     |||.:..:.|  :.:::||...|:|..|.||:|:....|.  |||.:||..:|:||
Mouse     2 FLLLIILQALAVAIAQSQG--DHKIIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITA 64

  Fly    71 AHCVTNQDSNGNSVPI---AAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRL 130
            |||..         ||   |..:..||.....:    .:|:||..:.|.:|....  ||:.||:|
Mouse    65 AHCAR---------PILHVALGKHNIRRWEATQ----QVVRVARQVPHPQYQPQAHDNDLMLLKL 116

  Fly   131 ESPLILSASIQPIDLPTADTPADVDVIISGWGRIKHQGDLPRY---LQYNTLKSISLERCDE--- 189
            :..:.|..:::.|.:.::.........:||||.|  ...:.||   ||...:..:|.:.|..   
Mouse   117 QKKVRLGRAVKTISVASSCASPGTPCRVSGWGTI--ASPIARYPTALQCVNVNIMSEQACHRAYP 179

  Fly   190 -LIGWGVQSELCL-IHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACG-TSYPDGYARVYYHNE 251
             :|..|:   :|. :.|....:|.||||||.|...|:.|:..:....|. ..||..||.:..::.
Mouse   180 GIITSGM---VCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHS 241

  Fly   252 WIK 254
            ||:
Mouse   242 WIQ 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 67/237 (28%)
Tryp_SPc 32..256 CDD:238113 69/239 (29%)
Klk14NP_777355.1 Tryp_SPc 24..246 CDD:238113 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.