DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG3795

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:290 Identity:85/290 - (29%)
Similarity:128/290 - (44%) Gaps:61/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLLLLAV-----------PVHSAPGSLNGR-------VVGG-----EDAVKNQFPHQVSLRN--- 51
            ::||::|           .:||||.....|       |.||     .|.||    :.||||.   
  Fly     9 YILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVK----YTVSLRMGKP 69

  Fly    52 ----AGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRF---SGGVLVQV 109
                ..:|.|.|:|.|...:||||||:.:     |...:.|::..:.||:..|.   |...:::.
  Fly    70 KKFFGDNHFCAGTIFSERAILTAAHCMFS-----NRRKLKAKKLMVVAGTPRRLLKSSTTQIIEA 129

  Fly   110 AEVIVHEEYGNFLN---DVALLRLESPLILSASIQPIDL----PTADTPADVDVIISGWGRIKHQ 167
            .|::.|.:|....:   |:.|:.||:.|.|..::..|.|    |.|..|..    |.|||.:...
  Fly   130 EELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCS----IVGWGTVIQF 190

  Fly   168 GDLPRYLQYNTLKSISLERCDELIGWGVQSELCL--IHEADNGACNGDSGGPAVYNNQVVGVAGF 230
            |.||.......::.:....|::|:||.....||.  .|::|..:|.||||||.:.:|.|.|:..|
  Fly   191 GPLPDEAINGDMQILPDTFCEKLLGWSNAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSF 255

  Fly   231 VWSACGTSYPDG---YARVYYHNEWIKNNS 257
               ..|...||.   |..||:..:||..||
  Fly   256 ---GMGCGEPDSAGIYTDVYHFRDWITENS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 74/255 (29%)
Tryp_SPc 32..256 CDD:238113 75/250 (30%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 69/232 (30%)
Tryp_SPc 60..278 CDD:214473 67/229 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.