DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and GZMA

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_006135.2 Gene:GZMA / 3001 HGNCID:4708 Length:262 Species:Homo sapiens


Alignment Length:262 Identity:60/262 - (22%)
Similarity:104/262 - (39%) Gaps:42/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDS 79
            |.:.|.:...|..:..:::||.:...:..|:.|.|.......|.|:::::::|||||||..|:.|
Human    12 LSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRS 76

  Fly    80 NGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY-------GNFLNDVALLRLESPLILS 137
               .|.:.|...|....:.         |:  ::|.:|:       .....|:.||:|.....::
Human    77 ---QVILGAHSITREEPTK---------QI--MLVKKEFPYPCYDPATREGDLKLLQLMEKAKIN 127

  Fly   138 ASIQPIDLPTA--DTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDE--------LIG 192
            ..:..:.||..  |........::||||..:.......|:...:..|..:.|::        :||
Human   128 KYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIG 192

  Fly   193 WGVQSELCLIHEADNGACNGDSGGPAVYNNQVVGVAGF-VWSACGTSYPDGYARVYY-----HNE 251
            ..:.....|  .....:||||||.|.:......||..| :.:.||.....|   ||.     |..
Human   193 MNMVCAGSL--RGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPG---VYILLSKKHLN 252

  Fly   252 WI 253
            ||
Human   253 WI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 55/244 (23%)
Tryp_SPc 32..256 CDD:238113 57/245 (23%)
GZMANP_006135.2 Tryp_SPc 29..254 CDD:238113 55/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.