DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Klk7

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:258 Identity:69/258 - (26%)
Similarity:118/258 - (45%) Gaps:30/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGSFLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHC 73
            ||....:||::.:.:|  ....|::.|....:...|.||:|.......|||.::..::|||||||
  Rat     5 LLSLLTVLLSLALETA--GQGERIIDGYKCKEGSHPWQVALLKGDQLHCGGVLVGESWVLTAAHC 67

  Fly    74 VTNQDSNGNSVPIAAERFTIRAGSNDRF--SGGVLVQVAEVIVHEEYG--NFLNDVALLRLESPL 134
            ...|             :|:..|| |:.  .....::.:....|..|.  ..:||:.|::::.|:
  Rat    68 KMGQ-------------YTVHLGS-DKIEDQSAQRIKASRSFRHPGYSTRTHVNDIMLVKMDKPV 118

  Fly   135 ILSASIQPIDLPTADTPADVDVIISGWGRIKHQG-DLPRYLQYNTLKSISLERC----DELIGWG 194
            .:|..:|.:.||....|......:||||...... ..|..|..:.:|.||.:.|    .:|:|  
  Rat   119 KMSDKVQKVKLPDHCEPPGTLCTVSGWGTTTSPDVTFPSDLMCSDVKLISSQECKKVYKDLLG-- 181

  Fly   195 VQSELCL-IHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACG-TSYPDGYARVYYHNEWIKN 255
             ::.||. |.::....||||||||.|.|:.:.|:..:....|| .:.|..|.:|..:..|:::
  Rat   182 -KTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYQRWLED 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 63/232 (27%)
Tryp_SPc 32..256 CDD:238113 63/235 (27%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 63/231 (27%)
Tryp_SPc 26..244 CDD:238113 63/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.