DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Klk9

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:242 Identity:64/242 - (26%)
Similarity:103/242 - (42%) Gaps:34/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRA 95
            |.||..:..:|..|.|..|.......||.::::..::||||||             ......:|.
  Rat    22 RAVGARECQRNSQPWQAGLFYLTRQLCGATLINDQWLLTAAHC-------------RKPYLWVRL 73

  Fly    96 GSND--RFSG-GVLVQVAEVIVHEEYGNFL------NDVALLRLESPLILSASIQPIDLPTADTP 151
            |.:.  ::.| ..|:.|.:...|..:...|      :|:.|:||...:.||.::||::|..:...
  Rat    74 GEHHLWQWEGPEKLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKVRLSPAVQPLNLSQSLPS 138

  Fly   152 ADVDVIISGWGRIKHQG-DLPRYLQYNTLKSISLERCDELIGW---GVQSE--LCL-IHEADNGA 209
            .....:|||||.:.... ..|..||...:..:.    ::|..|   |..||  ||. :.|...|:
  Rat   139 VGTQCLISGWGSVSSSKIQFPMTLQCANISILD----NKLCRWAYPGHISEKMLCAGLWEGGRGS 199

  Fly   210 CNGDSGGPAVYNNQVVGVAGFVWSACG-TSYPDGYARVYYHNEWIKN 255
            |.||||||.|....:.|:.......|. ...|..|..|:::.:||:|
  Rat   200 CQGDSGGPLVCKGTLAGIVSGGSEPCSRPQRPAVYTSVFHYLDWIEN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 61/238 (26%)
Tryp_SPc 32..256 CDD:238113 63/241 (26%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 63/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.