DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Mcpt1

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_058841.1 Gene:Mcpt1 / 29265 RGDID:3062 Length:247 Species:Rattus norvegicus


Alignment Length:281 Identity:72/281 - (25%)
Similarity:121/281 - (43%) Gaps:83/281 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SFLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSL----RNAGSHSCGGSILSRNYVLTAAH 72
            :.|.|:|:.:.|..|:  ..::||.:::.:..|:...|    ......||||.:::|.:||||||
  Rat     3 ALLFLMALLLPSGAGA--EEIIGGVESIPHSRPYMAHLDIITERGLKDSCGGFLITRQFVLTAAH 65

  Fly    73 CVTNQDSNGNSVPIAAERFTIRAGSND---RFSGGVLVQVAEVIVHEEYGNF---LNDVALLRLE 131
            |      .|..:       |:..|::|   |......::|.:..:|:.| ||   |:|:.||:||
  Rat    66 C------RGREI-------TVTLGAHDVSKREYTQQKIKVEKQFIHKNY-NFLPNLHDIMLLKLE 116

  Fly   132 SPLILSASIQPIDLPTADTPADVDVII--------SGWGR--IKHQGDLPRYLQYNTLKSISLER 186
            ..:.|:.::..:.||   :|:|   .|        :||||  :|....       :||:.::|..
  Rat   117 KQVELTPAVDVVPLP---SPSD---FIHPGTLCWTAGWGRTGVKDPTS-------DTLREVALRI 168

  Fly   187 CDELIGWGVQSELCLIH-EADNG-------------ACNGDSGGPAVYNNQVVGVAGFVWSACGT 237
            .||        |.|.|: ..||.             |..||||||.:....|.|:..:       
  Rat   169 MDE--------EACKIYRHYDNNFQVCVGLSTRLQTAYTGDSGGPLLCAGVVHGIVSY------- 218

  Fly   238 SYPDG-----YARVYYHNEWI 253
            .:||.     :.|:..:..||
  Rat   219 GHPDATPPAVFTRIAPYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 65/260 (25%)
Tryp_SPc 32..256 CDD:238113 67/261 (26%)
Mcpt1NP_058841.1 Tryp_SPc 20..239 CDD:214473 65/260 (25%)
Tryp_SPc 21..242 CDD:238113 67/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.