DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Prss38

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:261 Identity:83/261 - (31%)
Similarity:126/261 - (48%) Gaps:41/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SAPG--SLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVP 85
            ||.|  :|:|:::|||..:..::|.|||:..||.|.||||||:..:|||||||            
  Rat   103 SACGQPALHGKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVLTAAHC------------ 155

  Fly    86 IAAERFTIRAGSNDRFSGGVLVQVA----------EVIVHEEYGNFL---NDVALLRLESPLILS 137
            .|.|:   |..:.|.:.|...::||          :||:|..:..|.   .||||::.:|.::.|
  Rat   156 FAREK---RLQTFDMYVGITNLEVANKHTQWFEINQVIIHPTFEMFHPVGGDVALVQSKSAIVFS 217

  Fly   138 ASIQPIDLPTAD-TPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIG---WGVQSE 198
            ..:.||.||::: ..:|:....:|||.:..||:..:.|....|..|...:|..|.|   :.:...
  Rat   218 DYVLPICLPSSNLNLSDLSCWTTGWGMVSPQGETGKDLLEAQLPLIPKFQCQLLYGLTSYLLPEM 282

  Fly   199 LCL--IHEADNGACNGDSGGPAVYN-NQV---VGVAGFVWSACGTSYPDGYARVYYHNEWIKNNS 257
            ||.  |....| .|.||||.|.|.. ||.   :|:..:........||..:|.|.|...||:.|.
  Rat   283 LCAGDIKNMKN-VCEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLNWIRYNM 346

  Fly   258 D 258
            :
  Rat   347 E 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 75/244 (31%)
Tryp_SPc 32..256 CDD:238113 77/246 (31%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 76/242 (31%)
Tryp_SPc 116..342 CDD:214473 75/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.