DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and LOC286960

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:267 Identity:78/267 - (29%)
Similarity:125/267 - (46%) Gaps:34/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VKAAILLGSFLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVL 68
            :|.:|........:|:||:.     :.::|||....|:..|:||||.:..||.||||::|..:||
  Rat     1 MKISIFFAFLGAAVALPVND-----DDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVL 60

  Fly    69 TAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRF---SGGVLVQVAEVIVHEEYG--NFLNDVALL 128
            :||||.             ..:..:|.|.::..   .|...:...::|.|.||.  ...||:.|:
  Rat    61 SAAHCY-------------KRKLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLI 112

  Fly   129 RLESPLILSASIQPIDLPTADTPADVDVIISGWGR-IKHQGDLPRYLQYNTLKSISLERCDELIG 192
            :|:||.:|::.:..:.||.:....|...::||||. :...|..|..||......:|...|.:...
  Rat   113 KLKSPAVLNSQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYP 177

  Fly   193 WGVQSEL-CL-IHEADNGACNGDSGGPAVYNNQVVGVAGFVW-SACG-TSYPDGYARVYYHNEWI 253
            ..:.|.: || ..|....:|:||||||.|.|.::.|:..  | |.|. ...|..|.:|..:..||
  Rat   178 GQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVS--WGSVCAMRGKPGVYTKVCNYLSWI 240

  Fly   254 K----NN 256
            :    ||
  Rat   241 QETMANN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 69/231 (30%)
Tryp_SPc 32..256 CDD:238113 71/237 (30%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 69/231 (30%)
Tryp_SPc 24..243 CDD:238113 71/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.