DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and TPSD1

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:236 Identity:73/236 - (30%)
Similarity:115/236 - (48%) Gaps:40/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLAVPVHSAPGSL---------NGRVVGGEDAVKNQFPHQVSLRNAG---SHSCGGSILSRNY 66
            |||||:||.::|..:         ...:|||::|.::::|.|||||..|   .|.||||::...:
Human    11 LLLLALPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSLIHPQW 75

  Fly    67 VLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLN--DVALLR 129
            ||||||||.....:     :||.|..:|  ....:....|:.|:.:|||.::.....  |:|||.
Human    76 VLTAAHCVEPDIKD-----LAALRVQLR--EQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLE 133

  Fly   130 LESPLILSASIQPIDLPTADT--PADVDVIISGWGRIKHQGDLPRYLQYNTLKSISL-----ERC 187
            ||.|:.:|:.|..:.||.|..  |..:...::|||.:.:...||.  .| .||.:.:     ..|
Human   134 LEEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPP--PY-PLKEVEVPVVENHLC 195

  Fly   188 DELIGWG---------VQSELCLIHEADNGACNGDSGGPAV 219
            :.....|         |:.::......::.:|.||||||.|
Human   196 NAEYHTGLHTGHSFQIVRDDMLCAGSENHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 65/210 (31%)
Tryp_SPc 32..256 CDD:238113 65/209 (31%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 65/209 (31%)
Tryp_SPc 38..240 CDD:214473 65/209 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152912
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7244
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.