DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and svh-1

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:260 Identity:70/260 - (26%)
Similarity:110/260 - (42%) Gaps:32/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAG--SHSCGGSILSRNYVLTAAHCVTN 76
            |..:.|....|..|...|||||.:.|...||...:|||..  :|.||.|||.:.:::|||||...
 Worm   695 LRYVEVNARDAAKSRIARVVGGFETVPGAFPWTAALRNKATKAHHCGASILDKTHLITAAHCFEE 759

  Fly    77 QDSNGNSVPIAAERFTIRAGSNDRFSGG-VLVQVAEVIVHEEYGN-FLNDVALLRLESPLI-LSA 138
            .:.      :::....:....|::..|. .:..:..:..:..|.: |.:|:|:|.:..|.| .:.
 Worm   760 DER------VSSYEVVVGDWDNNQTDGNEQIFYLQRIHFYPLYKDIFSHDIAILEIPYPGIEFNE 818

  Fly   139 SIQPIDLPTAD---TPADVDVIISGWGRIKHQGDLPRY---LQYNTLKSISLERC---DELIGWG 194
            ..|||.||:.|   ||.. ..::||||.:.     .||   ||...:..|:...|   .::....
 Worm   819 YAQPICLPSKDFVYTPGR-QCVVSGWGSMG-----LRYAERLQAALIPIINRFDCVNSSQIYSSM 877

  Fly   195 VQSELCLIH-EADNGACNGDSGGPAVYNNQ-----VVGVAGFVWSACGTSYPDGYARVYYHNEWI 253
            .:|..|..: |....:|.||||||.....:     :.||..:.........|..|..|..:..||
 Worm   878 SRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWI 942

  Fly   254  253
             Worm   943  942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 64/241 (27%)
Tryp_SPc 32..256 CDD:238113 65/242 (27%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 65/242 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.