DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CFD

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001304264.1 Gene:CFD / 1675 HGNCID:2771 Length:260 Species:Homo sapiens


Alignment Length:235 Identity:65/235 - (27%)
Similarity:103/235 - (43%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIR 94
            ||::||.:|..:..|:..|::..|:|.|||.:::..:||:||||:.:.......|.:.|...:..
Human    31 GRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQP 95

  Fly    95 AGSNDRFSGGVLVQVAEVIVH--EEYGNFLNDVALLRLESPLILSASIQPIDLPTAD------TP 151
            ..|..      |..|...:.|  .:.....:|:.||:|.....|..:::|:.....|      |.
Human    96 EPSKR------LYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTL 154

  Fly   152 ADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIGW-GVQSELCLIHEAD-NGACNGDS 214
            .||    :|||.:.|.|..|..||:..|..:....|:..... |..:|..:..|:: ..:|.|||
Human   155 CDV----AGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDS 215

  Fly   215 GGPAVYNNQVVGVAGFVWSACGTSYPDG-YARVYYHNEWI 253
            |||.|....:.||.......||.....| |.||..:..||
Human   216 GGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 62/232 (27%)
Tryp_SPc 32..256 CDD:238113 63/233 (27%)
CFDNP_001304264.1 Tryp_SPc 32..255 CDD:214473 62/232 (27%)
Tryp_SPc 33..258 CDD:238113 63/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.