DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Klk1b16

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_032480.1 Gene:Klk1b16 / 16615 MGIID:891982 Length:261 Species:Mus musculus


Alignment Length:262 Identity:83/262 - (31%)
Similarity:119/262 - (45%) Gaps:32/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQ 77
            ||.|....:.:|| .:..|:|||....||..|.||::.....|.|||.:|.||:|||||||..::
Mouse     7 FLALSLGGIDAAP-PVQSRIVGGFKCEKNSQPWQVAVYYHKEHICGGVLLDRNWVLTAAHCYVDE 70

  Fly    78 -------DSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY---GNFLNDVALLRLES 132
                   :......|.|..|...::..:..|:       ..::..|:.   .:|.||:.||||..
Mouse    71 CEVWLGKNQLFQEEPSAQNRLVSKSFPHPGFN-------MTLLTFEKLPPGADFSNDLMLLRLSK 128

  Fly   133 PLILSASIQPIDLPTADTPADVDVIISGWGRI---KHQGDLPRYLQYNTLKSISLERCDELIGWG 194
            |..::..::||||||.:...|...::||||.|   |.|  .|..||....|.:..|.|.:.....
Mouse   129 PADITDVVKPIDLPTKEPKLDSTCLVSGWGSITPTKWQ--KPDDLQCMFTKLLPNENCAKAYLLK 191

  Fly   195 VQS-ELCLIHEA-DNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYH----NEWI 253
            |.. .||.|... |.|.|.||||||.:.:..:.|........||.   .|.:.:|.:    |.||
Mouse   192 VTDVMLCTIEMGEDKGPCVGDSGGPLICDGVLQGTVSIGPDPCGI---PGVSAIYTNLVKFNSWI 253

  Fly   254 KN 255
            |:
Mouse   254 KD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 75/240 (31%)
Tryp_SPc 32..256 CDD:238113 77/243 (32%)
Klk1b16NP_032480.1 Tryp_SPc 25..256 CDD:238113 77/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.