DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and PRSS36

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:276 Identity:79/276 - (28%)
Similarity:112/276 - (40%) Gaps:39/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GSFLLLLAVPVHSAPGSL-------NGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVL 68
            |:|......|....|..|       :.|:|||.:|....:|.||||.:.|.|.||||:::.::||
Human    19 GAFQDSALSPTQEEPEDLDCGRPEPSARIVGGSNAQPGTWPWQVSLHHGGGHICGGSLIAPSWVL 83

  Fly    69 TAAHCVTNQDSNGNSVPIAAERFTIRAGSND-RFSGGVLVQVAEVIVHEEYG--NFLNDVALLRL 130
            :||||..   :||...|.|.....:...|.| ...|.....||.::|...|.  ....|:|||||
Human    84 SAAHCFM---TNGTLEPAAEWSVLLGVHSQDGPLDGAHTRAVAAIVVPANYSQVELGADLALLRL 145

  Fly   131 ESPLILSASIQPIDLPTAD------TPADVDVIISGWGRIKHQGDLPR--YLQYNTLKSISLERC 187
            .||..|..::.|:.||.|.      |..    ..:|||.::....||.  .||...|:.:....|
Human   146 ASPASLGPAVWPVCLPRASHRFVHGTAC----WATGWGDVQEADPLPLPWVLQEVELRLLGEATC 206

  Fly   188 DELIGWG---------VQSELCLIH-EADNGACNGDSGGPAVYNNQ----VVGVAGFVWSACGTS 238
            ..|....         :...||..: |.....|.||||||.|....    ..|:..|.:.....:
Human   207 QCLYSQPGPFNLTLQILPGMLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGITSFGFGCGRRN 271

  Fly   239 YPDGYARVYYHNEWIK 254
            .|..:..|..:..||:
Human   272 RPGVFTAVATYEAWIR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 72/246 (29%)
Tryp_SPc 32..256 CDD:238113 73/248 (29%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 72/246 (29%)
Tryp_SPc 47..289 CDD:238113 73/248 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.