DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Prss28

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:274 Identity:77/274 - (28%)
Similarity:129/274 - (47%) Gaps:42/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLAV-----PVHSAPGSLNGR----VVGGEDAVKNQFPHQVSLR------NAGSHSCGGSILS 63
            |||||:     .|..|..|::..    :|||:.....::|.|||||      |:..|.|||||:.
Mouse     4 LLLLALSCLESTVFMASVSISRSKPVGIVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIH 68

  Fly    64 RNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLN--DVA 126
            ..::||||||:.:||::    |..   :.::.|....:....|:.::.:|:|.:|.:...  |:|
Mouse    69 PQWILTAAHCIQSQDAD----PAV---YRVQVGEVYLYKEQELLNISRIIIHPDYNDVSKRFDLA 126

  Fly   127 LLRLESPLILSASIQPIDLPTADTPADV--DVIISGWGRIKHQGDLPRYLQYNTLK-----SISL 184
            |::|.:.|:.|.::.|:.||...:..|.  ...:.|||.:..:..|....|.:.:|     :.|.
Mouse   127 LMQLTALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDNKSC 191

  Fly   185 ERC------DELIGWGVQSELCLIHEADNGACNGDSGGPAV--YNNQVVGVAGFVWSA--CGTSY 239
            :|.      ||.....:..::.....:..|.|.||||||.|  .:|:.:.| |.|...  |..:.
Mouse   192 KRAYRKKSSDEHKAVAIFDDMLCAGTSGRGPCFGDSGGPLVCWKSNKWIQV-GVVSKGIDCSNNL 255

  Fly   240 PDGYARVYYHNEWI 253
            |..::||.....||
Mouse   256 PSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 67/250 (27%)
Tryp_SPc 32..256 CDD:238113 69/247 (28%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 69/247 (28%)
Tryp_SPc 31..269 CDD:214473 67/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842988
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.