DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and LOC101730924

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_031761513.1 Gene:LOC101730924 / 101730924 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:250 Identity:78/250 - (31%)
Similarity:123/250 - (49%) Gaps:22/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQD 78
            ||||.|.:.:|....:.:::||....||..|:.||| |:|.|.||||:::..:|::||||.    
 Frog     3 LLLLCVLLGAAAAFDDDKIIGGATCAKNSVPYIVSL-NSGYHFCGGSLINNQWVVSAAHCY---- 62

  Fly    79 SNGNSVPIAAERFTIRAGS-NDRFSGGV--LVQVAEVIVHEEYGNFL--NDVALLRLESPLILSA 138
                     .....:|.|. |...|.|.  .:..::||.|..|.::.  ||:.|::|.|...|:|
 Frog    63 ---------KASIQVRLGEHNIALSEGTEQFISSSKVIRHSGYNSWTLDNDIMLIKLSSAASLNA 118

  Fly   139 SIQPIDLPTADTPADVDVIISGWGRIKHQG-DLPRYLQYNTLKSISLERCDELI-GWGVQSELCL 201
            ::..:.||:....|....:|||||.....| :.|..||......::..:|:... |....:.:||
 Frog   119 AVNAVALPSGCAAAGTSCLISGWGNTLSSGSNYPDLLQCLYAPILTDAQCNNAYPGEITNNMICL 183

  Fly   202 -IHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIKN 255
             ..|....:|.||||||.|.|.|:.||..:.:.....:||..|.:|..:|.||::
 Frog   184 GFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNYNSWIQS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 70/229 (31%)
Tryp_SPc 32..256 CDD:238113 72/231 (31%)
LOC101730924XP_031761513.1 Tryp_SPc 21..239 CDD:238113 72/231 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.