DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and zgc:163079

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:266 Identity:73/266 - (27%)
Similarity:118/266 - (44%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 APGSLNGRVVGGEDAVKNQFPHQ--VSLRNAGSHSCGGSILSRNYVLTAAHC------------V 74
            ||  ||.:::||.:|.:..:|.|  ::|:......||||::::.:|||.|..            :
Zfish    30 AP--LNTKIIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWVLTTAKVFALMPASDIVVYL 92

  Fly    75 TNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPLILSAS 139
            ..|..||:: |....|                 .|.::|.|..|.:..:::|||:|.||:..|..
Zfish    93 GRQTQNGSN-PYEISR-----------------TVTKIIKHPNYNSLDSNLALLKLSSPVTFSDY 139

  Fly   140 IQPIDLPTADTPADVDVI---ISGWGRIKHQGD-----LPRYLQYNTLKSISLERCDELIGWGVQ 196
            |:|:.|..|.: ..||..   ::|||.:.....     ||..||......::...|:...|..:.
Zfish   140 IKPVCLAAAGS-VFVDGTASWVTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFECNAAYGGIIT 203

  Fly   197 SE-LC--LIHEADNGACNGDSGGPAVYNNQVVGV-AGFVWSA-CG-TSYPDGYARVYYHNEWIK- 254
            :: ||  .::|.....|.||.|||.|.....:.: :|.|.|. || ..||..|.||..:.:||. 
Zfish   204 NKLLCAGYLNEDGKAPCAGDVGGPLVIKQGAIWIQSGVVVSGYCGLPGYPTIYVRVSEYEDWISY 268

  Fly   255 -NNSDV 259
             .||.:
Zfish   269 YTNSSL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 65/249 (26%)
Tryp_SPc 32..256 CDD:238113 67/253 (26%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 65/249 (26%)
Tryp_SPc 36..267 CDD:238113 66/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587691
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.