DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and gzm3

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001122022.1 Gene:gzm3 / 100000986 ZFINID:ZDB-GENE-070912-132 Length:253 Species:Danio rerio


Alignment Length:261 Identity:71/261 - (27%)
Similarity:125/261 - (47%) Gaps:26/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGSFLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCV 74
            |.:||||||:   |..|.::..::||:.|..:..|:...::|. ..:|||.::..:|:||||||:
Zfish     3 LCTFLLLLAI---SLAGGMDSGIIGGKVAKPHSRPYMAFIQNK-FEACGGMLIRDDYILTAAHCL 63

  Fly    75 TNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLN------DVALLRLESP 133
            .|.|.:...|.:.|...:....|..|      :||.:.|.|..:.|..|      |:.||:|::.
Zfish    64 NNNDRSHFEVVLGAHNISKHEKSQQR------IQVKKHIQHPMFLNSNNEKDYSYDIMLLKLKNK 122

  Fly   134 LILSASIQPIDLPTAD--TPADVDVIISGWGRIKHQGDLPR-YLQYNTLKSISLERCDELIGW-- 193
            ..::..::.:.||..:  .|.:|...|:|||..:..|:.|. .|:..|:|..:...|:.  .|  
Zfish   123 AKINKFVKVLSLPKKNEKLPENVKCSIAGWGTKESNGNKPSDVLEEVTVKLQNNHECER--KWQQ 185

  Fly   194 --GVQSELCLIHEADNGACNGDSGGPAVYNNQVVGVAGF-VWSACGTSYPDGYARVYYHNEWIKN 255
              ..:...|.:.:..:..|.||||.|.:.|.:...:|.: |...|..::|..:.::.....|||.
Zfish   186 HFNPERMFCSVSDGKHAFCRGDSGSPLICNTKPQAIASYTVKKDCLHTHPQVFVKISCFLPWIKK 250

  Fly   256 N 256
            |
Zfish   251 N 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 58/235 (25%)
Tryp_SPc 32..256 CDD:238113 61/237 (26%)
gzm3NP_001122022.1 Tryp_SPc 22..251 CDD:238113 61/237 (26%)
Tryp_SPc 22..248 CDD:214473 58/234 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.