DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and TPSAB1

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:272 Identity:85/272 - (31%)
Similarity:127/272 - (46%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLFLVLPVQS-------APGKLNGRV--VGGEDAVKNQFPHQVSLRNAG---SHSCGGSILTRTY 66
            ||.|.|||.:       |||:...||  |||::|.::::|.|||||..|   .|.||||::...:
Human     4 LLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQW 68

  Fly    67 ILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY--GNFLNDVALLR 129
            :|||||||..:     :..:||.|..:|  ....:....|:.|:.:|||.::  .....|:|||.
Human    69 VLTAAHCVGPD-----VKDLAALRVQLR--EQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLE 126

  Fly   130 LESPLILSASIQPIDLPTVDT--PADVDVVISGWGRIKHQGDLPRYLQYNTLK--SITRQQCEEL 190
            ||.|:.:|:.:..:.||....  |..:...::|||.:.:...||.......:|  .:....|:..
Human   127 LEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAK 191

  Fly   191 IDFG-FEGE---------LCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVV---DGCGS-TYPD 241
            ...| :.|:         || .......:|.||||||.|.......:...||   :||.. ..|.
Human   192 YHLGAYTGDDVRIVRDDMLC-AGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPG 255

  Fly   242 GYARVFYFKDWI 253
            .|.||.|:.|||
Human   256 IYTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 74/246 (30%)
Tryp_SPc 32..256 CDD:238113 75/247 (30%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 74/245 (30%)
Tryp_SPc 31..267 CDD:214473 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.