DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Klk10

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_598473.1 Gene:Klk10 / 69540 MGIID:1916790 Length:278 Species:Mus musculus


Alignment Length:275 Identity:71/275 - (25%)
Similarity:125/275 - (45%) Gaps:49/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLCSFLLFLVLPVQS--APGKLNGRV---VGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYIL 68
            ||...|:..:...|:  .||... ||   ..|....::..|.||||.:.....|.|.::.:.::|
Mouse    20 LLLPLLMVQLWAAQALLLPGNAT-RVDLEASGAQCERDYHPWQVSLFHNLQFQCAGVLVDQNWVL 83

  Fly    69 TAAHCVSNEDVNHVITPIAAERFTIRAGSND--RFSGGVLVQVAEVIVHEEY----GNFL----- 122
            |||||..|:       |:.|     |.|.:.  .|....|...:..:.|.:|    |..|     
Mouse    84 TAAHCWRNK-------PLRA-----RVGDDHLLLFQKEQLRSTSSPVFHPKYQACSGPILPHRSD 136

  Fly   123 -NDVALLRLESPLILSASIQPIDLPTVDTPADVDVVISGWG-----RIKHQGDLPRYLQYNTLKS 181
             :|:.:|:|.||::|::::.|:.||...:....:..:||||     |:|:.    |.|..:.:..
Mouse   137 EHDLMMLKLSSPVMLTSNVHPVQLPFRCSQPGQECQVSGWGTSASRRVKYN----RSLSCSKVTL 197

  Fly   182 ITRQQCEELIDFGFEG-----ELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGST-YP 240
            ::::|||..    :.|     .:|.....:..:|..|||||.|.::.|.||..:.:..||:. :|
Mouse   198 LSQKQCETF----YPGVITNSMICAEADGNQDSCQSDSGGPLVCDDTLHGVLSWGIYPCGAAQHP 258

  Fly   241 DGYARVFYFKDWIKK 255
            ..|:.:..:..||::
Mouse   259 SVYSEICKYTPWIRR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 63/247 (26%)
Tryp_SPc 32..256 CDD:238113 64/250 (26%)
Klk10NP_598473.1 Tryp_SPc 50..271 CDD:214473 61/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.