DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and LOC683849

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:274 Identity:83/274 - (30%)
Similarity:123/274 - (44%) Gaps:66/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SFLLFLVL-------PVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILT 69
            |.||.|.|       ||..     :.::|||....:|..|:|||| |:|.|.||||::...::::
  Rat     2 SALLILALVGTAVAFPVDD-----DDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVS 60

  Fly    70 AAHCVSNEDVNHVITPIAAERFTIRAG--------SNDRFSGGVLVQVAEVIVHEEYG--NFLND 124
            ||||..:             |..:|.|        .|::|     |..|::|.|..:.  ...||
  Rat    61 AAHCYKS-------------RIQVRLGEHNINVLEGNEQF-----VNAAKIIKHPNFDRKTLNND 107

  Fly   125 VALLRLESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQG-DLPRYLQYNTLKSITRQQCE 188
            :.|::|.||:.|:|.:..:.||:...||....:|||||.....| :.|..||......:.:..||
  Rat   108 IMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCE 172

  Fly   189 ---------ELIDFGF-EGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDG- 242
                     .::..|| ||        ...:|.||||||.|.|.:|.|:..:   |.|...||. 
  Rat   173 ASYPGKITDNMVCAGFLEG--------GKDSCQGDSGGPVVCNGELQGIVSW---GYGCALPDNP 226

  Fly   243 --YARVFYFKDWIK 254
              |.:|..:.|||:
  Rat   227 GVYTKVCNYVDWIE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 74/245 (30%)
Tryp_SPc 32..256 CDD:238113 76/247 (31%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 74/245 (30%)
Tryp_SPc 24..242 CDD:238113 76/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.