DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and prss1

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:268 Identity:80/268 - (29%)
Similarity:123/268 - (45%) Gaps:46/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVAILLCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILT 69
            |..|||..|.:....|:    |..:.::|||.:..||..|:|||| |:|.|.||||:::..::::
Zfish     2 KAFILLALFAVAYAAPL----GDDDDKIVGGYECTKNGVPYQVSL-NSGYHFCGGSLISNLWVVS 61

  Fly    70 AAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAE----------VIVHEEY-GNFL- 122
            ||||..:             |..:|.|.::       :.|.|          ||.|..| .|.| 
Zfish    62 AAHCYKS-------------RVQVRLGEHN-------IDVTEGTEQFINSEKVIRHPSYNSNTLD 106

  Fly   123 NDVALLRLESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQG-DLPRYLQYNTLKSITRQQ 186
            |||.|::|.|...:::.::.:.||:....:....:|||||.:...| :.|..|.......::...
Zfish   107 NDVMLIKLSSSAQINSYVKTVSLPSSCASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDST 171

  Fly   187 CEELIDFGFEGELCLLHQVDNG--ACNGDSGGPAVYNNQLVGVA--GFVVDGCGS-TYPDGYARV 246
            |...........:.....::.|  :|.||||||.|.||||.|:.  |:   ||.. ..|..||:|
Zfish   172 CRNAYPGQISSNMFCAGFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGY---GCAQRNKPGVYAKV 233

  Fly   247 FYFKDWIK 254
            ..|..||:
Zfish   234 CNFTTWIR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 71/239 (30%)
Tryp_SPc 32..256 CDD:238113 73/241 (30%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 71/239 (30%)
Tryp_SPc 25..243 CDD:238113 73/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.