DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG34458

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:269 Identity:89/269 - (33%)
Similarity:139/269 - (51%) Gaps:34/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVAILLCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILT 69
            |::|||.: :.|:...:..|.   ..|::||:.|...||||||||:..|.|.||||:::.|.|:|
  Fly     9 KLSILLLA-VTFVHSDMDVAE---ESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVT 69

  Fly    70 AAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSG-GVLVQVAEVIVHEEYG----NFLNDVALLR 129
            ||||...::...:...:         |:||..:| |....:|:.|:|..|.    :|  |::|::
  Fly    70 AAHCTMGQNPGQMKAIV---------GTNDLSAGNGQTFNIAQFIIHPRYNPQSQDF--DMSLIK 123

  Fly   130 LESPLILSASIQPIDLPTVDT--PADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELID 192
            |.||:.:..::|.|.|...|:  .||...:|||:|.|.....||..|::..::..:|..|.....
  Fly   124 LSSPVPMGGAVQTIQLADSDSNYAADTMAMISGFGAINQNLQLPNRLKFAQVQLWSRDYCNSQNI 188

  Fly   193 FGFEGEL-CLLH---QVDNGACNGDSGGPAVYNNQLVGVA--GFVVDGCGST-YPDGYARVFYFK 250
            .|....: |..|   ||  .:|.||||||...:.:|.||.  ||   |||:. .|..|..|...:
  Fly   189 PGLTDRMVCAGHPSGQV--SSCQGDSGGPLTVDGKLFGVVSWGF---GCGAKGRPAMYTYVGALR 248

  Fly   251 DWIKKHSDV 259
            .|||::::|
  Fly   249 SWIKQNANV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 79/235 (34%)
Tryp_SPc 32..256 CDD:238113 81/237 (34%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 79/235 (34%)
Tryp_SPc 32..254 CDD:238113 81/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.