DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Klk4

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:258 Identity:73/258 - (28%)
Similarity:115/258 - (44%) Gaps:36/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLLFLVLPVQSA-PGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSN 76
            ||..|:|.|..| ...::.|::.|:|...:..|.|.:|.:.....|.|.::...::|:||||:. 
Mouse    12 FLGCLILEVTGASASSVSSRIIQGQDCSPHSQPWQAALFSEDGFFCSGVLVHPQWVLSAAHCLQ- 75

  Fly    77 EDVNHVITPIAAERFTIRAG----SNDRFSGGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLI 135
                        |.:.:..|    ...:..|..:::....|.|..:.  :|.||:.|::|...:|
Mouse    76 ------------ESYIVGLGLHNLKGSQEPGSRMLEAHLSIQHPNFNDPSFANDLMLIKLNESVI 128

  Fly   136 LSASIQPIDLPT-VDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELID------- 192
            .|.:|:.|.:.| ..||.|. .::||||::|: |.||..||...|...:.:.|..|.|       
Mouse   129 ESNTIRSIPVATQCPTPGDT-CLVSGWGQLKN-GKLPSLLQCVNLSVASEETCRLLYDPVYHLSM 191

  Fly   193 FGFEGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGST-YPDGYARVFYFKDWIK 254
            |...|     .|....:||||||||.|.|..|.|:.......||.. .|..|..:..|.:||:
Mouse   192 FCAGG-----GQDQKDSCNGDSGGPIVCNRSLQGLVSMGQGKCGQPGIPSVYTNLCKFTNWIQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 65/236 (28%)
Tryp_SPc 32..256 CDD:238113 66/238 (28%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 66/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.