DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and AZU1

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:231 Identity:70/231 - (30%)
Similarity:105/231 - (45%) Gaps:27/231 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRAG 96
            :|||..|...|||...|::|.|.|.|||:::...:::|||.|..::  |..::.:....:.:|  
Human    27 IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQ--NPGVSTVVLGAYDLR-- 87

  Fly    97 SNDRFSGGVLVQVAEVIVHEEYG----NFLNDVALLRL--ESPLILSASIQPIDLPTVDTPADVD 155
            ..:|.|.    |...:....|.|    ..|||:.||:|  |:.|..|.:|.|:.|......|...
Human    88 RRERQSR----QTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTR 148

  Fly   156 VVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELIDFGFEGELC---LLHQVDNGACNGDSGGP 217
            ..::|||..:..|.|.|:.::..:......||.       ...:|   |..:  .|.||||.|.|
Human   149 CQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCR-------PNNVCTGVLTRR--GGICNGDGGTP 204

  Fly   218 AVYNNQLVGVAGFVVDGCGSTYPDGYARVFYFKDWI 253
            .|......|||.|.:..||.. ||.:.||..|:|||
Human   205 LVCEGLAHGVASFSLGPCGRG-PDFFTRVALFRDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 68/229 (30%)
Tryp_SPc 32..256 CDD:238113 70/231 (30%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 70/231 (30%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 10/23 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.