DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and PRTN3

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:259 Identity:79/259 - (30%)
Similarity:122/259 - (47%) Gaps:38/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLR---NAGSHSCGGSILTRTYILTAA 71
            |.|.||.|:|...:...:    :|||.:|..:..|:..||:   |.|||.|||:::..:::||||
Human    10 LASVLLALLLSGAARAAE----IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAA 70

  Fly    72 HCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHE-EYGNFLNDVALLRLESPLI 135
            ||:.:.....|...:.|.....:..:...||      ||:|.::. :..|.||||.|::|.||..
Human    71 HCLRDIPQRLVNVVLGAHNVRTQEPTQQHFS------VAQVFLNNYDAENKLNDVLLIQLSSPAN 129

  Fly   136 LSASIQPIDLPTVDTPA--DVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELIDFGFEGE 198
            ||||:..:.||..|.|.  ....:..||||:.......:.||...:..:|              .
Human   130 LSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVT--------------F 180

  Fly   199 LCLLHQV-------DNGACNGDSGGPAVYNNQLVGVAGFVVDGCGS-TYPDGYARVFYFKDWIK 254
            .|..|.:       ..|.|.||||||.:.:..:.|:..||:.||.: .:||.:.||..:.|||:
Human   181 FCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 71/235 (30%)
Tryp_SPc 32..256 CDD:238113 73/237 (31%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.