DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and KLK10

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:245 Identity:70/245 - (28%)
Similarity:106/245 - (43%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRAGSND 99
            |....:...|.||||.|..|..|.|.::.::::||||||.:.        |:.|     |.|.:.
Human    49 GSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNK--------PLWA-----RVGDDH 100

  Fly   100 --RFSGGVLVQVAEVIVHEEY----GNFL------NDVALLRLESPLILSASIQPIDLP-TVDTP 151
              ...|..|.:....:||.:|    |..|      :|:.||:|..|::|...::.:.|| ....|
Human   101 LLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQP 165

  Fly   152 ADVDVVISGWG-----RIKHQGDLPRYLQYNTLKSIT---RQQCEELIDFGFEGELCLLHQVDNG 208
            .| ...::|||     |:|:...|       |..|||   .::||.... |......:...:|.|
Human   166 GD-QCQVAGWGTTAARRVKYNKGL-------TCSSITILSPKECEVFYP-GVVTNNMICAGLDRG 221

  Fly   209 --ACNGDSGGPAVYNNQLVGVAGFVVDGCGST-YPDGYARVFYFKDWIKK 255
              .|..|||||.|.:..|.|:..:.|..|||. :|..|.::..:..||.|
Human   222 QDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 67/241 (28%)
Tryp_SPc 32..256 CDD:238113 70/245 (29%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 70/245 (29%)
Tryp_SPc 49..269 CDD:214473 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.