DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Klk11

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:261 Identity:68/261 - (26%)
Similarity:113/261 - (43%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLCSFLLFLVLPVQSAPGKLNG--RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAA 71
            ||.:.::..::.:....|.:.|  |::.|.:...:..|.||:|.......||.:::...::||||
Mouse    23 LLQARMILRLIALALVTGHVGGETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAA 87

  Fly    72 HCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFL------NDVALLRL 130
            ||..    .|.:..:.........|...|      ....|...|.::.|.|      ||:.|:::
Mouse    88 HCRK----PHYVILLGEHNLEKTDGCEQR------RMATESFPHPDFNNSLPNKDHRNDIMLVKM 142

  Fly   131 ESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKH-QGDLPRYLQYNTLKSITRQQCEELIDFG 194
            .||:..:.::||:.|......|....:|||||.... |..||..|:...:..|..::||:    .
Mouse   143 SSPVFFTRAVQPLTLSPHCVAAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIEHKECEK----A 203

  Fly   195 FEGE-----LCL-LHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDG-YARVFYFKDW 252
            :.|.     ||. :.:....:|.||||||.|.|..|.|:..:..|.|..|...| |.:|..:.:|
Mouse   204 YPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFNW 268

  Fly   253 I 253
            |
Mouse   269 I 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 62/235 (26%)
Tryp_SPc 32..256 CDD:238113 63/236 (27%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 62/235 (26%)
Tryp_SPc 48..272 CDD:238113 63/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.