Sequence 1: | NP_523426.1 | Gene: | Ser6 / 33073 | FlyBaseID: | FBgn0011834 | Length: | 259 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021335658.1 | Gene: | si:dkey-33m11.7 / 565163 | ZFINID: | ZDB-GENE-141216-115 | Length: | 214 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 51/197 - (25%) |
---|---|---|---|
Similarity: | 83/197 - (42%) | Gaps: | 38/197 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 IAAERFTIRAG-SNDRFSGGVLVQVAEVIVHEEYGNFLN--DVALLRLESPLILSASIQPIDLPT 147
Fly 148 VDTP--ADVDVVISGWGRIKHQGDL-PRYLQYNTLKSITRQQCEELIDFGFEGEL---------- 199
Fly 200 ------C------LLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGS-TYPDGYARVFYFKD 251
Fly 252 WI 253 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ser6 | NP_523426.1 | Tryp_SPc | 31..253 | CDD:214473 | 49/195 (25%) |
Tryp_SPc | 32..256 | CDD:238113 | 51/197 (26%) | ||
si:dkey-33m11.7 | XP_021335658.1 | Tryp_SPc | <2..196 | CDD:238113 | 51/197 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D469244at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |