DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and PRSS1

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:255 Identity:77/255 - (30%)
Similarity:121/255 - (47%) Gaps:34/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNED 78
            :|..|....:||...:.::|||.:..:|..|:|||| |:|.|.||||::...::::|.||..:  
Human   231 ILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSL-NSGYHFCGGSLINEQWVVSAGHCYKS-- 292

  Fly    79 VNHVITPIAAERFTIRAG--------SNDRFSGGVLVQVAEVIVHEEYG--NFLNDVALLRLESP 133
                       |..:|.|        .|::|     :..|::|.|.:|.  ...||:.|::|.|.
Human   293 -----------RIQVRLGEHNIEVLEGNEQF-----INAAKIIRHPQYDRKTLNNDIMLIKLSSR 341

  Fly   134 LILSASIQPIDLPTVDTPADVDVVISGWGRIKHQG-DLPRYLQYNTLKSITRQQCEELIDFGFEG 197
            .:::|.:..|.|||.........:|||||.....| |.|..||......:::.:||.........
Human   342 AVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITS 406

  Fly   198 ELCLLHQVDNG--ACNGDSGGPAVYNNQLVGVAGFVVDGCG-STYPDGYARVFYFKDWIK 254
            .:..:..::.|  :|.||||||.|.|.||.||..: .|||. ...|..|.:|:.:..|||
Human   407 NMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSW-GDGCAQKNKPGVYTKVYNYVKWIK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 70/235 (30%)
Tryp_SPc 32..256 CDD:238113 73/237 (31%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 70/235 (30%)
Tryp_SPc 249..467 CDD:238113 73/237 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.