DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:262 Identity:74/262 - (28%)
Similarity:118/262 - (45%) Gaps:34/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILLCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNA-GSHSCGGSILTRTYILTAA 71
            :|||..|..|.:..|..   :..|:|||.........:.||:::| |.|.|||:::.:.::||||
Zfish     6 LLLCVLLEILAVSCQDV---IQARIVGGYVPAPYSIKYIVSIQSATGQHFCGGTLINKYWVLTAA 67

  Fly    72 HCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAE------VIVHEEYGNFLN--DVALL 128
            ||           .|......|.||.   :|.|:...:.:      :|.|.:|....|  |:.|:
Zfish    68 HC-----------NIGEANMRIVAGD---YSVGLYEGMEQFRRPHMLIPHPQYDRSTNNADIMLI 118

  Fly   129 RLESPLILSASIQPIDLPTVDTPADVDVV--ISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELI 191
            :|:||:.|::.:..:.||..|....|..:  :||||.....|.:...|:...|..::...|....
Zfish   119 KLQSPVYLNSYVSLVPLPRQDAMVAVGRLCSVSGWGFTTSTGGISSILRTVKLPIVSTAVCNGTD 183

  Fly   192 DFG---FEGELCLLHQV-DNGACNGDSGGPAVYNNQLVGVAGFVVDGCG-STYPDGYARVFYFKD 251
            .|.   .|..:|..:.. ...||.||||||.|...::.|:..: .:||. :.||..|..|..|:.
Zfish   184 SFNGNITENMICAGYSTGGKDACKGDSGGPLVCEGRVYGIVSW-GNGCADAQYPGVYTAVSQFRQ 247

  Fly   252 WI 253
            ||
Zfish   248 WI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 66/237 (28%)
Tryp_SPc 32..256 CDD:238113 67/238 (28%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 66/237 (28%)
Tryp_SPc 27..252 CDD:238113 67/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.