DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and prss60.2

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:269 Identity:82/269 - (30%)
Similarity:126/269 - (46%) Gaps:32/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLCSFLLFLVLPVQS---------APGKLNGRVVGGEDAVKNQFPHQVSLRNA--GSHSCGGSIL 62
            |.|:.|..|:....|         ||  ||.|:|||.:|.:..:|.||||::.  |.|.||||::
Zfish     4 LTCATLTLLICVKGSLSQLNVCGQAP--LNSRIVGGVNAPEGSWPWQVSLQSPRYGGHFCGGSLI 66

  Fly    63 TRTYILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFL--NDV 125
            :..::||||||:.....:.::..:...   .:.|.|...:..   .||::|||..|.:..  ||:
Zfish    67 SSEWVLTAAHCLPGVSESSLVVYLGRR---TQQGVNTHETSR---NVAKIIVHSSYNSNTNDNDI 125

  Fly   126 ALLRLESPLILSASIQPIDLPTVDT--PADVDVVISGWGRIKHQGDLPR--YLQYNTLKSITRQQ 186
            |||||.|.:..:..|:|:.|...::  .|.....|:|||.::...:||.  .||...:..:...:
Zfish   126 ALLRLSSAVTFNDYIRPVCLAAQNSVYSAGTSSWITGWGDVQAGVNLPAPGILQETMIPVVANDR 190

  Fly   187 CEELIDFG--FEGELCL-LHQVDNGACNGDSGGPAVYNNQLVGV-AGFVVDGCGSTYPDG---YA 244
            |...:..|  ....:|. |.:.....|.||||||.|.....|.: ||....|.|...|:.   |.
Zfish   191 CNAQLGSGTVTNNMICAGLAKGGKDTCQGDSGGPMVTRLCTVWIQAGITSWGYGCADPNSPGVYT 255

  Fly   245 RVFYFKDWI 253
            ||..::.||
Zfish   256 RVSQYQSWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 71/236 (30%)
Tryp_SPc 32..256 CDD:238113 72/237 (30%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 71/236 (30%)
Tryp_SPc 34..267 CDD:238113 72/237 (30%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.