DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and PLAT

DIOPT Version :10

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_000921.1 Gene:PLAT / 5327 HGNCID:9051 Length:562 Species:Homo sapiens


Alignment Length:263 Identity:74/263 - (28%)
Similarity:115/263 - (43%) Gaps:54/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGEDAVKNQFPHQVSL-----RNAGSH-SCGGSILTRTYILTAAHCVSNEDVNHVITPIAAE 89
            |:.||..|.....|.|.::     |:.|.. .|||.:::..:||:||||.......|.:|.|...
Human   310 RIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGR 374

  Fly    90 RFTIRAGSNDRFSGGVLVQVAEVIVHEEYGN--FLNDVALLRL---------ESPLILSASIQPI 143
            .:.:..|..::     ..:|.:.|||:|:.:  :.||:|||:|         ||.::.:..:.|.
Human   375 TYRVVPGEEEQ-----KFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPA 434

  Fly   144 DLPTVDTPADVDVVISGWGRIKHQGDLPRYLQ-----YNTLKSITRQQCEELI------------ 191
            ||   ..|...:..:||:|  ||:...|.|.:     :..|...:|...:.|:            
Human   435 DL---QLPDWTECELSGYG--KHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAG 494

  Fly   192 DFGFEGELCLLHQVDNGACNGDSGGPAVYNNQ----LVGVAGFVVDGCG-STYPDGYARVFYFKD 251
            |....|....||.    ||.||||||.|..|.    |||:..:.: ||| ...|..|.:|..:.|
Human   495 DTRSGGPQANLHD----ACQGDSGGPLVCLNDGRMTLVGIISWGL-GCGQKDVPGVYTKVTNYLD 554

  Fly   252 WIK 254
            ||:
Human   555 WIR 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 32..256 CDD:238113 73/262 (28%)
PLATNP_000921.1 FN1 41..83 CDD:214494
Important for binding to annexin A2 42..52
EGF 86..117 CDD:394967
KR 125..209 CDD:238056
Kringle 215..296 CDD:395005
Tryp_SPc 313..559 CDD:238113 73/260 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.