DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and epsilonTry

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:264 Identity:92/264 - (34%)
Similarity:140/264 - (53%) Gaps:28/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VAILLCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTA 70
            :::|.|:  |...:|....| :|:||:|||.:...:..|:||||:..|||.|||||.:...::||
  Fly     8 LSVLACA--LAGTIPDGLLP-QLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITA 69

  Fly    71 AHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGN--FLNDVALLRLESP 133
            |||:.:         |.|:...||.||....|||.:..|.....||.|.:  .:||:|::|:||.
  Fly    70 AHCLQS---------IEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESD 125

  Fly   134 LILSASIQPIDLPTVDTPADVDVVISGWGRIKHQGD-LPRYLQYNTLKSITRQQCEELIDFGF-- 195
            |...:||:.|.:...:.......|:||||..:..|. :|.:|....|:.|...:|.. .:||:  
  Fly   126 LSFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRS-DEFGYGK 189

  Fly   196 ---EGELCLLHQVDNGACNGDSGGPAVYNNQLVGVA--GFVVDGCGST-YPDGYARVFYFKDWIK 254
               :..|| .:.....||.||||||.|..::||||.  |:   |||.. ||..||.|.:|.:||:
  Fly   190 KIKDTMLC-AYAPHKDACQGDSGGPLVSGDRLVGVVSWGY---GCGDVRYPGVYADVAHFHEWIE 250

  Fly   255 KHSD 258
            :.::
  Fly   251 RTAE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 83/232 (36%)
Tryp_SPc 32..256 CDD:238113 84/234 (36%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 83/232 (36%)
Tryp_SPc 31..252 CDD:238113 84/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.